Structure of PDB 7r49 Chain H

Receptor sequence
>7r49H (length=77) Species: 1036177 (Lactiplantibacillus plantarum subsp. plantarum NC8) [Search protein sequence]
DDTKATVLSILADLTGEDVSSNMDVNLFDEGILDSMGSVQLLLELQNQLG
IEVPVSEFQRSEWDTPAKIVAKVENLQ
3D structure
PDB7r49 DltC acts as an interaction hub for AcpS, DltA and DltB in the teichoic acid D-alanylation pathway of Lactiplantibacillus plantarum.
ChainH
Resolution1.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PNS H D37 S38 D34 S35
Gene Ontology
Molecular Function
GO:0036370 D-alanyl carrier activity
Biological Process
GO:0019350 teichoic acid biosynthetic process
GO:0070395 lipoteichoic acid biosynthetic process
GO:0070400 teichoic acid D-alanylation
GO:0071555 cell wall organization
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r49, PDBe:7r49, PDBj:7r49
PDBsum7r49
PubMed35907949
UniProtQ88VM8|DLTC1_LACPL D-alanyl carrier protein 1 (Gene Name=dltC1)

[Back to BioLiP]