Structure of PDB 7qwt Chain H

Receptor sequence

>7qwtH (length=351) Species: 392499 (Rhizorhabdus wittichii RW1)

STFECLKRAWYVAAMSSEVEGEALFHRRILGTSVMIYRLADGTPVAMHDR
CPHRFAPLHLGQREGDEIACRYHALRFDADGRCTHNPHGNGRIPDAARVR
RFPLLERYGFLWIWMDDSDPDPALLPDFSPLEEGHPNAVAQTYMHMDVNY
ELIIDNVMDLSHIDHVHGEIITTRGQLSPVVPKVRERDTHISARWEWSQT
PAMMIFAPFLPRPEDAARHYFDISWTAPANIQLSVGAVQDSDDFGDATSQ
YDLHTCTPEDAFKTHYFFATRRNHIVDDADYNRKKIEAMHAAFETEDGPI
ITAVQEEMGEAEFFSLDPVLMSNDVAPVKVRRRLRRMIVEEQAAAAAADA
A

3D structure

• PDB: 7qwt Discovery, characterization, and metabolic engineering of Rieske non-heme iron monooxygenases for guaiacol O-demethylation
• Chain: H
• Resolution: 3.712 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	H	C53 H55 R56 C72 Y74 H75 L77	C51 H53 R54 C70 Y72 H73 L75
BS02	FE	H	H164 H169 D299	H162 H167 D297

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 04:54:57 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7qwt', asym_id = 'H', title = 'Discovery, characterization, and metabolic engin... iron monooxygenases for guaiacol O-demethylation'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7qwt', asym_id='H', title='Discovery, characterization, and metabolic engin... iron monooxygenases for guaiacol O-demethylation')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491,0051537', uniprot = '', pdbid = '7qwt', asym_id = 'H'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491,0051537', uniprot='', pdbid='7qwt', asym_id='H')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>