Structure of PDB 7qgr Chain H

Receptor sequence
>7qgrH (length=80) Species: 562 (Escherichia coli) [Search protein sequence]
KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNEC
GIGDVVEIRECRPLSKTKSWTLVRVVEKAV
3D structure
PDB7qgr Ribosome collisions induce mRNA cleavage and ribosome rescue in bacteria.
ChainH
Resolution5.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H R6 S14 K16 M17 E18 K19 R27 F28 I33 Y34 F37 R40 T41 T42 K43 L44 H45 E63 R65 P66 L67 S68 K69 K71 S72 W73 R3 S11 K13 M14 E15 K16 R24 F25 I30 Y31 F34 R37 T38 T39 K40 L41 H42 E60 R62 P63 L64 S65 K66 K68 S69 W70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qgr, PDBe:7qgr, PDBj:7qgr
PDBsum7qgr
PubMed35264790
UniProtP0AG63|RS17_ECOLI Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]