Structure of PDB 7qgg Chain H

Receptor sequence

>7qggH (length=225) Species: 10116 (Rattus norvegicus) [Search protein sequence]

NFAELKVKRLRKKFALKTLRKARRKLIYEKAKHYHKEYRQMYRTEIRMAR
MARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFV
KLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNS
LVARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKK
TTHFVEGGDAGNREDQINRLIRRMN

3D structure

PDB

7qgg Neuronal RNA granules are ribosome complexes stalled at the pre-translocation state.

Chain

Resolution

2.86 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	R146 E149 K234 T236 H238 V240 E241	R111 E114 K199 T201 H203 V205 E206
BS02	rna	H	N36 F37 L40 K43 R44 R46 K47 F49 R55 R58 R59 K60 Y63 E64 H70 Y73 Y77 R78 T79 I81 R82 R85 M86 R88 R108 G109 I110 N111 P115 K116 K119 L123 R125 I129 K139 A140 N143 M144 L159 K160 N163 K168 R169 N175 K177 R178 S185 A188 R189 G192 K193 F194 K211 R212 K214 N218 K224 L225 S226 S227 P228 R229 M232 K234 K235 R254 R257	N1 F2 L5 K8 R9 R11 K12 F14 R20 R23 R24 K25 Y28 E29 H35 Y38 Y42 R43 T44 I46 R47 R50 M51 R53 R73 G74 I75 N76 P80 K81 K84 L88 R90 I94 K104 A105 N108 M109 L124 K125 N128 K133 R134 N140 K142 R143 S150 A153 R154 G157 K158 F159 K176 R177 K179 N183 K189 L190 S191 S192 P193 R194 M197 K199 K200 R219 R222

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0042802	identical protein binding

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364	rRNA processing
GO:0042273	ribosomal large subunit biogenesis
GO:0097421	liver regeneration

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0014069	postsynaptic density
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0031672	A band
GO:0045202	synapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qgg, PDBe:7qgg, PDBj:7qgg
PDBsum	7qgg
PubMed	36038000
UniProt	P05426\|RL7_RAT Large ribosomal subunit protein uL30 (Gene Name=Rpl7)

[Back to BioLiP]