Structure of PDB 7qco Chain H

Receptor sequence
>7qcoH (length=81) Species: 1378066 (Chroococcidiopsis sp. TS-821) [Search protein sequence]
SHSVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAGQIAASPRTEDCVGC
KRCETACPTDFLSIRVYLSNAETTRSMGLAY
3D structure
PDB7qco Cryo-EM structure of a tetrameric photosystem I from Chroococcidiopsis TS-821, a thermophilic, unicellular, non-heterocyst-forming cyanobacterium.
ChainH
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.97.1.12: photosystem I.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 H C20 T22 V24 C47 V48 G49 C50 K51 C53 C20 T22 V24 C47 V48 G49 C50 K51 C53
BS02 SF4 H C10 I11 G12 C13 T14 Q15 C16 C57 S63 C10 I11 G12 C13 T14 Q15 C16 C57 S63
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009773 photosynthetic electron transport in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qco, PDBe:7qco, PDBj:7qco
PDBsum7qco
PubMed35059628
UniProtA0A2S6VD54

[Back to BioLiP]