Structure of PDB 7pir Chain H

Receptor sequence

>7pirH (length=128) Species: 272634 (Mycoplasmoides pneumoniae M129)

QSYYGLGRRKSSSAKVYLTPTQDKGKITVNRRDPSEYFPNKLVIQDMEQP
LDLTDLKKNFDINVVVKGGGFTGQAGAIRLGIVRALLQFNPELKKILKSK
KLTTRDKRVKERKKFGLYGARRAPQFTK

3D structure

• PDB: 7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: H
• Resolution: 12.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	Y7 R11 R12 K13 S14 S16 K18 Y20 N33 R34 Y40 P42 N43 N66 V67 V68 K70 G71 G72 G73 F74 T75 G76 R87 K97 K98 K101 T107 R108 K110 R111 V112 K113 E114 R115 K116 K117 F118 G119 Y121 A123 R124 R125 A126 P127 Q128 F129 K131	Y4 R8 R9 K10 S11 S13 K15 Y17 N30 R31 Y37 P39 N40 N63 V64 V65 K67 G68 G69 G70 F71 T72 G73 R84 K94 K95 K98 T104 R105 K107 R108 V109 K110 E111 R112 K113 K114 F115 G116 Y118 A120 R121 R122 A123 P124 Q125 F126 K128

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pir, PDBe:7pir, PDBj:7pir
• PDBsum: 7pir
• PubMed: 36171285
• UniProt: P75179|RS9_MYCPN Small ribosomal subunit protein uS9 (Gene Name=rpsI)