Structure of PDB 7pi5 Chain H

Receptor sequence
>7pi5H (length=67) Species: 3046 (Dunaliella salina) [Search protein sequence]
EPGIVTPLGTLLRPLNSEAGKVLPGWGTTVLMAVAILLFAVFLLIILEIY
NSSLILDGVTNSWESLA
3D structure
PDB7pi5 Structure of Dunaliella Photosystem II reveals conformational flexibility of stacked and unstacked supercomplexes.
ChainH
Resolution2.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA H F60 I64 Y68 F42 I46 Y50
BS02 CLA H T46 M50 I54 T28 M32 I36
BS03 CLA H L30 N34 L12 N16
BS04 CLA H T24 L26 G27 T6 L8 G9
BS05 CLA H L55 L62 L37 L44
BS06 RRX H A53 I54 F57 F60 A35 I36 F39 F42
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pi5, PDBe:7pi5, PDBj:7pi5
PDBsum7pi5
PubMed36799903
UniProtA0A1C8XRP3

[Back to BioLiP]