Structure of PDB 7phx Chain H

Receptor sequence

>7phxH (length=247) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVI

3D structure

• PDB: 7phx Synthesis and evaluation of peptidic thrombin inhibitors bearing acid-stable sulfotyrosine analogues.
• Chain: H
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	D326 E328 I329 G330 M331 P333 W334 D433 H436 P437 C439 Y454 K455 R457 N484 M531 K532 N537 R538 W539	D6 E8 I9 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N157 M204 K205 N210 R211 W212
BS02	peptide	H	H363 Y367 P369 W370 R409 E414 N415 L416 R418 R443 L450 Q451 A452 E489 R490 I499 D503 N504 A520 E522 S525 W547 G548 G550 H562 F564 R565 K567 K568	H43 Y47 P49 W50 R89 E94 N95 L96 R98 R123 L130 Q131 A132 E162 R163 I172 D176 N177 A193 E195 S198 W220 G221 G223 H235 F237 R238 K240 K241

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:7phx, PDBe:7phx, PDBj:7phx
• PDBsum: 7phx
• PubMed: 34596182
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)