Structure of PDB 7oi7 Chain H

Receptor sequence

>7oi7H (length=95) Species: 9606 (Homo sapiens)

TVIVERWWKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKENLELILTQSV
ENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLR

3D structure

• PDB: 7oi7 A distinct assembly pathway of the human 39S late pre-mitoribosome.
• Chain: H
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	W60 K61 L64 A65 G66 H74 R75 R78 L82 D85 K87 H88 K91 S117 N121	W8 K9 L12 A13 G14 H22 R23 R26 L30 D33 K35 H36 K39 S65 N69

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oi7, PDBe:7oi7, PDBj:7oi7
• PDBsum: 7oi7
• PubMed: 34315873
• UniProt: Q9BYD2|RM09_HUMAN Large ribosomal subunit protein bL9m (Gene Name=MRPL9)