Structure of PDB 7nkp Chain H

Receptor sequence
>7nkpH (length=46) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
DLATFVFTRTTAGEIGILPRHIPLVAQLVDDAMVRVEFLSVTEETV
3D structure
PDB7nkp Structure of the ATP synthase from Mycobacterium smegmatis provides targets for treating tuberculosis.
ChainH
Resolution4.06 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide H T28 I32 P40 L41 V42 Q44 T11 I15 P23 L24 V25 Q27
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0015986 proton motive force-driven ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7nkp, PDBe:7nkp, PDBj:7nkp
PDBsum7nkp
PubMed34782468
UniProtA0R1Z9|ATPE_MYCS2 ATP synthase epsilon chain (Gene Name=atpC)

[Back to BioLiP]