Structure of PDB 7msc Chain H

Receptor sequence
>7mscH (length=47) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
MKLILTADVDHLGSIGDTVEVKDGYGRNFLLPRGLAIVASRGAQKQA
3D structure
PDB7msc Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
ChainH
Resolution2.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H K22 G24 Y25 N28 F29 R33 R41 Q44 K45 K22 G24 Y25 N28 F29 R33 R41 Q44 K45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7msc, PDBe:7msc, PDBj:7msc
PDBsum7msc
PubMed35064151
UniProtP9WH79|RL9_MYCTU Large ribosomal subunit protein bL9 (Gene Name=rplI)

[Back to BioLiP]