Structure of PDB 7lv0 Chain H

Receptor sequence

>7lv0H (length=206) Species: 83333 (Escherichia coli K-12)

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEI

3D structure

• PDB: 7lv0 Structural basis for +1 ribosomal frameshifting during EF-G-catalyzed translocation.
• Chain: H
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	G1 Q2 K3 V4 K26 R126 S153 G154 R155 E160 I161 A162 W166 R168 R171 V172 P173 L174 H175 T176 L177 R178 T191 Y192 G193 V194 K198	G1 Q2 K3 V4 K26 R126 S153 G154 R155 E160 I161 A162 W166 R168 R171 V172 P173 L174 H175 T176 L177 R178 T191 Y192 G193 V194 K198

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

External links

• PDB: RCSB:7lv0, PDBe:7lv0, PDBj:7lv0
• PDBsum: 7lv0
• PubMed: 34330903
• UniProt: P0A7V3|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)