Structure of PDB 7lde Chain H

Receptor sequence
>7ldeH (length=162) Species: 10090 (Mus musculus) [Search protein sequence]
VQVLLTTIGAFSAFGLMTIAISTDYWLYTRGLTHSGLWRICCLEGLKRGV
CVKINHFAEYLLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIIL
GAGILFVAAGLSNIIGVIVYISANAGKNHYSYGWSFYFGGLSFILAEVIG
VLAVNIYIERSR
3D structure
PDB7lde Hippocampal AMPA receptor assemblies and mechanism of allosteric inhibition.
ChainH
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 XVD H N172 V176 I180 F205 G208 G209 N113 V117 I121 F136 G139 G140
Gene Ontology
Molecular Function
GO:0005246 calcium channel regulator activity
GO:0005262 calcium channel activity
GO:0005515 protein binding
Biological Process
GO:0006816 calcium ion transport
GO:0070588 calcium ion transmembrane transport
GO:0099072 regulation of postsynaptic membrane neurotransmitter receptor levels
GO:2000311 regulation of AMPA receptor activity
Cellular Component
GO:0005886 plasma membrane
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0032281 AMPA glutamate receptor complex
GO:0034702 monoatomic ion channel complex
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098839 postsynaptic density membrane
GO:0098978 glutamatergic synapse
GO:1990454 L-type voltage-gated calcium channel complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lde, PDBe:7lde, PDBj:7lde
PDBsum7lde
PubMed33981040
UniProtQ8VHW2|CCG8_MOUSE Voltage-dependent calcium channel gamma-8 subunit (Gene Name=Cacng8)

[Back to BioLiP]