Structure of PDB 7l0g Chain H |
>7l0gH (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] |
VPTKLEVVAATPTSLLISWDAPAVTVFFYVITYGETGHGVGAFQAFKVPG SKSTATISGLKPGVDYTITVYARGYSKQGPYKPSPISINYRT |
|
PDB | 7l0g Selective and noncovalent targeting of RAS mutants for inhibition and degradation. |
Chain | H |
Resolution | 2.54 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GSP |
H |
V43 G44 F46 |
V40 G41 F43 |
|
|
|