Structure of PDB 7k7g Chain H

Receptor sequence
>7k7gH (length=92) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAA
YNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS
3D structure
PDB7k7g Structural and dynamic mechanisms of CBF3-guided centromeric nucleosome formation.
ChainH
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H S91 T92 S55 T56
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006301 postreplication repair
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7k7g, PDBe:7k7g, PDBj:7k7g
PDBsum7k7g
PubMed33741944
UniProtP02293|H2B1_YEAST Histone H2B.1 (Gene Name=HTB1)

[Back to BioLiP]