Structure of PDB 7k63 Chain H

Receptor sequence

>7k63H (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]

KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA

3D structure

PDB

7k63 Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.

Chain

Resolution

3.03 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	H	S32 R33 Y42 G53 I54 S55 S56 R86 S87 T88	S3 R4 Y13 G24 I25 S26 S27 R57 S58 T59
BS02	dna	H	R31 R33 K34 S36 I39 Y40	R2 R4 K5 S7 I10 Y11

Gene Ontology

	Molecular Function
GO:0001530	lipopolysaccharide binding
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0002227	innate immune response in mucosa
GO:0006325	chromatin organization
GO:0006334	nucleosome assembly
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway
GO:0019731	antibacterial humoral response
GO:0031640	killing of cells of another organism
GO:0042742	defense response to bacterium
GO:0050829	defense response to Gram-negative bacterium
GO:0050830	defense response to Gram-positive bacterium
GO:0061644	protein localization to CENP-A containing chromatin
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide

	Cellular Component
GO:0000786	nucleosome
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0043505	CENP-A containing nucleosome

External links

PDB	RCSB:7k63, PDBe:7k63, PDBj:7k63
PDBsum	7k63
PubMed	33238161
UniProt	P06899\|H2B1J_HUMAN Histone H2B type 1-J (Gene Name=H2BC11)