Structure of PDB 7jsl Chain H

Receptor sequence
>7jslH (length=83) Species: 9606 (Homo sapiens) [Search protein sequence]
IQLWHFILELLRKEEYQGVIAWQGDYGEFVIKDPDEVARLWGVRKCKPQM
NYDKLSRALRYYYNKRILHKTKGKRFTYKFNFN
3D structure
PDB7jsl Structural Insight into the DNA Binding Function of Transcription Factor ERF.
ChainH
Resolution4.51 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H R83 R86 Y89 K96 F102 R57 R60 Y63 K70 F76
BS02 dna H Q28 L29 W67 K71 K73 M76 K80 Y88 Q2 L3 W41 K45 K47 M50 K54 Y62
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7jsl, PDBe:7jsl, PDBj:7jsl
PDBsum7jsl
PubMed33175491
UniProtP50548|ERF_HUMAN ETS domain-containing transcription factor ERF (Gene Name=ERF)

[Back to BioLiP]