Structure of PDB 7f0d Chain H

Receptor sequence
>7f0dH (length=47) Species: 419947 (Mycobacterium tuberculosis H37Ra) [Search protein sequence]
MKLILTADVDHLGSIGDTVEVKDGYGRNFLLPRGLAIVASRGAQKQA
3D structure
PDB7f0d Cryo-EM structure of Mycobacterium tuberculosis 50S ribosomal subunit bound with clarithromycin reveals dynamic and specific interactions with macrolides.
ChainH
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H D10 K22 D23 Y25 N28 F29 R41 K45 D10 K22 D23 Y25 N28 F29 R41 K45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f0d, PDBe:7f0d, PDBj:7f0d
PDBsum7f0d
PubMed34935599
UniProtA5TYC7|RL9_MYCTA Large ribosomal subunit protein bL9 (Gene Name=rplI)

[Back to BioLiP]