Structure of PDB 7eyi Chain H

Receptor sequence

>7eyiH (length=112) Species: 9606 (Homo sapiens) [Search protein sequence]

SHMQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVH
MRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRS
DHLHRHLKKDGC

3D structure

PDB

7eyi Structural basis for human ZBTB7A action at the fetal globin promoter.

Chain

Resolution

2.401 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	H	K486 K487 D488	K108 K109 D110
BS02	dna	H	Q422 D423 K426 Y438 S478 D479 H482 R483	Q44 D45 K48 Y60 S100 D101 H104 R105
BS03	dna	H	Q392 K396 R399 H400 T403 R421 K424 Y451 R458 R464 R477 H480 R483	Q14 K18 R21 H22 T25 R43 K46 Y73 R80 R86 R99 H102 R105
BS04	ZN	H	C412 C415 H428 H432	C34 C37 H50 H54
BS05	ZN	H	C440 C443 H456 H460	C62 C65 H78 H82
BS06	ZN	H	C384 C387 H400 H404	C6 C9 H22 H26
BS07	ZN	H	C471 H484	C93 H106

External links

PDB	RCSB:7eyi, PDBe:7eyi, PDBj:7eyi
PDBsum	7eyi
PubMed	34592153
UniProt	O95365\|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)