Structure of PDB 7eda Chain H

Receptor sequence
>7edaH (length=62) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNS
TLILDGVNVSWK
3D structure
PDB7eda Cryo-EM structure of monomeric photosystem II at 2.78 angstrom resolution reveals factors important for the formation of dimer.
ChainH
Resolution2.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA H F38 F41 I45 L46 Y49 F37 F40 I44 L45 Y48
BS02 CLA H T27 M31 F34 M35 T26 M30 F33 M34
BS03 CLA H L11 L14 N15 L10 L13 N14
BS04 CLA H T5 W6 L7 G8 T4 W5 L6 G7
BS05 RRX H F34 M35 L37 F38 F41 I44 F33 M34 L36 F37 F40 I43
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7eda, PDBe:7eda, PDBj:7eda
PDBsum7eda
PubMed34216574
UniProtP19052|PSBH_THEVL Photosystem II reaction center protein H (Fragment) (Gene Name=psbH)

[Back to BioLiP]