Structure of PDB 7dz7 Chain H

Receptor sequence
>7dz7H (length=100) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
KYGENSRYFDLQDMENTTGSWDMYGVDEKKRYPDNQAKFFTQATDIISRR
ESLRALVALSGIAAIVTYGLKGAKDADLPITKGPQTTGENGKGGSVRSRL
3D structure
PDB7dz7 Structural basis of LhcbM5-mediated state transitions in green algae.
ChainH
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA H A94 Y98 A64 Y68
BS02 CLA H T97 K101 G102 D105 T67 K71 G72 D75
BS03 CLA H F69 Q72 A73 D75 I76 F39 Q42 A43 D45 I46
BS04 CLA H R61 Y62 Q66 R31 Y32 Q36
BS05 CLA H P63 Q66 F69 F70 P33 Q36 F39 F40
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dz7, PDBe:7dz7, PDBj:7dz7
PDBsum7dz7
PubMed34239095
UniProtP13352|PSAH_CHLRE Photosystem I reaction center subunit VI, chloroplastic (Gene Name=PSAH)

[Back to BioLiP]