Structure of PDB 7as8 Chain H

Receptor sequence

>7as8H (length=164) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

NRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQNAKAID
SAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLD
KLISVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQKVRGMDIVIVTTANTD
EEARELLTQVGMPF

3D structure

• PDB: 7as8 Structural Basis for Bacterial Ribosome-Associated Quality Control by RqcH and RqcP.
• Chain: H
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	S73 A75 R80	S72 A74 R79
BS02	rna	H	N37 G39 V40 G41 T68 K71 K72 F77 I85 K88 K120 S121 F122 D123 T129 L130 G131 I132 R150 G151 M152 D153	N36 G38 V39 G40 T67 K70 K71 F76 I84 K87 K119 S120 F121 D122 T128 L129 G130 I131 R137 G138 M139 D140
BS03	rna	H	D23 S24 M26 Q27 Q63 K64 V66 V89 T90 R92	D22 S23 M25 Q26 Q62 K63 V65 V88 T89 R91

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7as8, PDBe:7as8, PDBj:7as8
• PDBsum: 7as8
• PubMed: 33259810
• UniProt: P12877|RL5_BACSU Large ribosomal subunit protein uL5 (Gene Name=rplE)