Structure of PDB 6zu9 Chain H

Receptor sequence
>6zu9H (length=141) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPL
LLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSK
NELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR
3D structure
PDB6zu9 A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
ChainH
Resolution6.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H K14 S15 G33 G71 G72 G73 S76 R122 R123 P124 E125 P126 K127 K128 F129 G130 G133 A134 R135 S136 Q139 K140 S141 Y142 R143 K12 S13 G31 G69 G70 G71 S74 R120 R121 P122 E123 P124 K125 K126 F127 G128 G131 A132 R133 S134 Q137 K138 S139 Y140 R141
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
GO:0006413 translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zu9, PDBe:6zu9, PDBj:6zu9
PDBsum6zu9
PubMed33289941
UniProtP0CX51|RS16A_YEAST Small ribosomal subunit protein uS9A (Gene Name=RPS16A)

[Back to BioLiP]