Structure of PDB 6zhx Chain H

Receptor sequence
>6zhxH (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence]
RRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEAS
RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
3D structure
PDB6zhx Mechanistic Insights into Regulation of the ALC1 Remodeler by the Nucleosome Acidic Patch.
ChainH
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H R27 K28 R30 K31 S33 I36 Y37 R2 K3 R5 K6 S8 I11 Y12
BS02 dna H R26 T29 R30 Y39 I51 S52 S53 R83 S84 T85 R1 T4 R5 Y14 I26 S27 S28 R58 S59 T60
BS03 peptide H H106 E110 H81 E85
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6zhx, PDBe:6zhx, PDBj:6zhx
PDBsum6zhx
PubMed33357431
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]