Structure of PDB 6z8x Chain H

Receptor sequence

>6z8xH (length=249) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQ

3D structure

• PDB: 6z8x Expanding the recognition interface of the thrombin-binding aptamer HD1 through modification of residues T3 and T12.
• Chain: H
• Resolution: 2.53 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 E192 G193 D194 S195 G196
• Catalytic site (residue number reindexed from 1): H43 D99 E195 G196 D197 S198 G199
• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 G25 M26 P28 W29 D116 H119 P120 C122 K135 R137 N159 K202 R206 W207	E8 I9 G10 M11 P13 W14 D113 H116 P117 C119 K135 R137 N157 K205 R211 W212
BS02	dna	H	H71 R75 Y76 R77A N78 I79 Y117	H66 R70 Y71 R73 N74 I75 Y114
BS03	0G6	H	H57 Y60A W60D L99 A190 C191 E192 G193 S195 S214 W215 G216	H43 Y47 W50 L96 A193 C194 E195 G196 S198 S219 W220 G221

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:6z8x, PDBe:6z8x, PDBj:6z8x
• PDBsum: 6z8x
• PubMed: 33614235
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)