Structure of PDB 6z8w Chain H

Receptor sequence

>6z8wH (length=251) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWGQ
PSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSG
GPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQ
F

3D structure

• PDB: 6z8w Expanding the recognition interface of the thrombin-binding aptamer HD1 through modification of residues T3 and T12.
• Chain: H
• Resolution: 1.73 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 E192 G193 D194 S195 G196
• Catalytic site (residue number reindexed from 1): H43 D99 E196 G197 D198 S199 G200
• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 G25 M26 P28 W29 D116 H119 C122 Y134 K135 R137 N159 K202 N205 R206 W207	E8 I9 G10 M11 P13 W14 D113 H116 C119 Y134 K135 R137 N158 K206 N211 R212 W213
BS02	dna	H	I24 R75 Y76 E77 R77A N78 I79 Y117	I9 R70 Y71 E72 R73 N74 I75 Y114
BS03	0G6	H	H57 Y60A W60D L99 D189 A190 S195 S214 W215 G216	H43 Y47 W50 L96 D193 A194 S199 S220 W221 G222

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:6z8w, PDBe:6z8w, PDBj:6z8w
• PDBsum: 6z8w
• PubMed: 33614235
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)