Structure of PDB 6z48 Chain H

Receptor sequence

>6z48H (length=253) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGKG
QPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDS
GGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVID
QFG

3D structure

• PDB: 6z48 Synthesis and direct assay of large macrocycle diversities by combinatorial late-stage modification at picomole scale.
• Chain: H
• Resolution: 2.27 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 M26 W29 D116 H119 P120 C122 L129C Y134 K135 R137 N159 K202 P204 N205 R206 W207	E8 M11 W14 D113 H116 P117 C119 L129 Y134 K135 R137 N159 K207 P209 N212 R213 W214
BS02	peptide	H	R75 P152 S153	R70 P152 S153
BS03	X1V	H	Y60A W60D N98 L99 I174 D189 A190 C191 E192 V213 S214 W215 G216 E217 G219 G226 F227 Y228	Y47 W50 N95 L96 I174 D194 A195 C196 E197 V220 S221 W222 G223 E224 G225 G233 F234 Y235
BS04	X1V	H	K36 N62	K21 N57

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:6z48, PDBe:6z48, PDBj:6z48
• PDBsum: 6z48
• PubMed: 35780129
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)