Structure of PDB 6y88 Chain H

Receptor sequence

>6y88H (length=264) Species: 287 (Pseudomonas aeruginosa)

SVPTVLQKILARKAEEVAERRARVNLAEVERLARSADAPRGFANALLERA
KRKEPAVIAEIKKASPSKGVLREHFVPAEIARSYEAGGAACLSVLTDVDF
FQGADAYLKEARAACALPVIRKDFMIDPYQIVEARAIGADCILLIVSALD
DVLMAELAATAKSVGLDVLVEVHDGTELERALKTLDTPLVGINNRNLHTF
EVSLETTLDLLPEIPRDRLVVTESGILNRADVELMEVSEVYAFLVGEAFM
RADDPGLELKRLFF

3D structure

• PDB: 6y88 Structure and kinetics of indole-3-glycerol phosphate synthase from Pseudomonas aeruginosa : Decarboxylation is not essential for indole formation.
• Chain: H
• Resolution: 2.09983 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E61 K63 K123 E172 N194 E224 S225
• Catalytic site (residue number reindexed from 1): E60 K62 K122 E171 N193 E223 S224
• Enzyme Commision number: 4.1.1.48: indole-3-glycerol-phosphate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	137	H	E61 K63 P67 S68 F102 K123 R196 E224 S225 L245 V246 G247 E248	E60 K62 P66 S67 F101 K122 R195 E223 S224 L244 V245 G246 E247
BS02	GOL	H	K14 R122 D124 Q131 E134	K13 R121 D123 Q130 E133

Gene Ontology

Molecular Function

• GO:0004425 indole-3-glycerol-phosphate synthase activity
• GO:0004640 phosphoribosylanthranilate isomerase activity
• GO:0016830 carbon-carbon lyase activity
• GO:0016831 carboxy-lyase activity

Biological Process

• GO:0000162 tryptophan biosynthetic process
• GO:0006568 tryptophan metabolic process

External links

• PDB: RCSB:6y88, PDBe:6y88, PDBj:6y88
• PDBsum: 6y88
• PubMed: 32928960
• UniProt: P20577|TRPC_PSEAE Indole-3-glycerol phosphate synthase (Gene Name=trpC)