Structure of PDB 6xlk Chain H

Receptor sequence
>6xlkH (length=268) Species: 562 (Escherichia coli) [Search protein sequence]
SQIGLFSKICRVTIKTLHYYNKIGLLVPAYINPDNGYRFYTSDQLMKFHQ
IASLRQLGFTITEIVTLTQDENSCHIIERRRLEIQKQIRDMADMLSRINH
YLQHKKKERIMLYQAALKEIPECIVYSKRFIVPDFSSYIKLIPPIGQEVM
KANPGLTLTTPAYCFTLYHDKEYKEKNMDVEFCEAVNDFGKNEGNIIFQV
IPAITAVTVIHKGPYDSLRNAYIYLMQWVEDNGYLLTNSPRESYIDGIWN
KQDSAEWMTEIQFPVEKV
3D structure
PDB6xlk Structural visualization of transcription activated by a multidrug-sensing MerR family regulator.
ChainH
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H Q3 I4 G5 H19 G37 Y38 R39 Q2 I3 G4 H18 G36 Y37 R38
BS02 dna H T14 K16 T17 Y20 Y21 N36 Y38 R56 T61 I62 T13 K15 T16 Y19 Y20 N35 Y37 R55 T60 I61
BS03 1N7 H Y169 E173 Y174 K175 Y223 Y168 E172 Y173 K174 Y222
BS04 118 H Y127 I143 G147 C165 F183 E185 W250 Y126 I142 G146 C164 F182 E184 W249
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 22 12:40:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6xlk', asym_id = 'H', title = 'Structural visualization of transcription activated by a multidrug-sensing MerR family regulator.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6xlk', asym_id='H', title='Structural visualization of transcription activated by a multidrug-sensing MerR family regulator.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003677,0003700,0006355', uniprot = '', pdbid = '6xlk', asym_id = 'H'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003700,0006355', uniprot='', pdbid='6xlk', asym_id='H')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>