Structure of PDB 6xgt Chain H

Receptor sequence

>6xgtH (length=159) Species: 5541 (Thermomyces lanuginosus)

DIATLDVTQHPYLPAYSKTLFEAKAAKKLTFEEIAKKIGRNEVATAALFY
GQAKASPEDIKNLSSVLGIPVAVLESQMSGFPDRGRSVEMPPKEPLIYRL
YEIVQNYGYAYKAVLNEKFGDGIMSAISFSTSVDKETDKDGNNWAVITLR
GKWLPYSRF

3D structure

• PDB: 6xgt Crystal structure of a thermophilic fungal cyanase and its implications on the catalytic mechanism for bioremediation.
• Chain: H
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MLI	H	I125 S127 I129 L156	I123 S125 I127 L154

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Feb 21 18:08:35 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6xgt', asym_id = 'H', title = 'Crystal structure of a thermophilic fungal cyana...ns on the catalytic mechanism for bioremediation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6xgt', asym_id='H', title='Crystal structure of a thermophilic fungal cyana...ns on the catalytic mechanism for bioremediation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003677,0008824,0009439', uniprot = '', pdbid = '6xgt', asym_id = 'H'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0008824,0009439', uniprot='', pdbid='6xgt', asym_id='H')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>