Structure of PDB 6w1v Chain H

Receptor sequence
>6w1vH (length=65) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNS
TLILDGVNVSWKALG
3D structure
PDB6w1v Untangling the sequence of events during the S2→ S3transition in photosystem II and implications for the water oxidation mechanism.
ChainH
Resolution2.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA H F41 I45 Y49 F40 I44 Y48
BS02 CLA H T27 M31 F34 T26 M30 F33
BS03 CLA H L11 L14 L10 L13
BS04 CLA H T5 L7 T4 L6
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w1v, PDBe:6w1v, PDBj:6w1v
PDBsum6w1v
PubMed32434915
UniProtQ8DJ43|PSBH_THEVB Photosystem II reaction center protein H (Gene Name=psbH)

[Back to BioLiP]