Structure of PDB 6vbw Chain H

Receptor sequence

>6vbwH (length=135) Species: 666 (Vibrio cholerae)

KTITFLPCNNESLAAKCLRVLHGFNYQYETRNIGVSFPLWCDATVGKKIS
FVSLLKQHYFVQMEQLQYFHIYVSFRRCQSIDKLTAAGLARKIRRLEKFD
PSSFAQKEHTAIAHYHSLGESSKQTNRNFRLNIRM

3D structure

• PDB: 6vbw Structure-function insights into the initial step of DNA integration by a CRISPR-Cas-Transposon complex.
• Chain: H
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	H29 Y33 Q105 K109 A113 R117 K118 R121 F138 Y149 K157 Q158 R161 N162 F163 R164	H22 Y26 Q79 K83 A87 R91 K92 R95 F104 Y115 K123 Q124 R127 N128 F129 R130

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 21:51:31 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6vbw', asym_id = 'H', title = 'Structure-function insights into the initial ste...A integration by a CRISPR-Cas-Transposon complex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6vbw', asym_id='H', title='Structure-function insights into the initial ste...A integration by a CRISPR-Cas-Transposon complex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004519,0043571', uniprot = '', pdbid = '6vbw', asym_id = 'H'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519,0043571', uniprot='', pdbid='6vbw', asym_id='H')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>