Structure of PDB 6tkh Chain H

Receptor sequence

>6tkhH (length=251) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
G

3D structure

• PDB: 6tkh Sulfotyrosine-Mediated Recognition of Human Thrombin by a Tsetse Fly Anticoagulant Mimics Physiological Substrates.
• Chain: H
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H363 D419 E522 G523 D524 S525 G526
• Catalytic site (residue number reindexed from 1): H43 D99 E195 G196 D197 S198 G199
• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	Y367 P369 H407 R409 E414 N415 L416 R418 R443 L450 Q451 A452 R490 I499 D503 N504 D519 A520 W547 G548 E549 G550 H562 F564 R565 K567 K568 K572	Y47 P49 H87 R89 E94 N95 L96 R98 R123 L130 Q131 A132 R163 I172 D176 N177 D192 A193 W220 G221 E222 G223 H235 F237 R238 K240 K241 K245

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:6tkh, PDBe:6tkh, PDBj:6tkh
• PDBsum: 6tkh
• PubMed: 33096052
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)