Structure of PDB 6swa Chain H

Receptor sequence
>6swaH (length=191) Species: 10090 (Mus musculus) [Search protein sequence]
MKTILSNQTVDIPENVEITLKGRTVIVKGPRGTLRRDFNHINVELSLLGK
KKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFP
INVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGND
IELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQAD
3D structure
PDB6swa Protein Synthesis in the Developing Neocortex at Near-Atomic Resolution Reveals Ebp1-Mediated Neuronal Proteostasis at the 60S Tunnel Exit.
ChainH
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H K21 R23 H40 N42 E44 K50 R64 K65 A68 R71 T72 S75 H76 N79 H98 F99 E120 K121 Y122 I151 E152 S155 Q163 K170 D171 K174 F175 K21 R23 H40 N42 E44 K50 R64 K65 A68 R71 T72 S75 H76 N79 H98 F99 E120 K121 Y122 I151 E152 S155 Q163 K170 D171 K174 F175
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0140236 translation at presynapse
GO:0140242 translation at postsynapse
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0045202 synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6swa, PDBe:6swa, PDBj:6swa
PDBsum6swa
PubMed33357414
UniProtP51410|RL9_MOUSE Large ribosomal subunit protein uL6 (Gene Name=Rpl9)

[Back to BioLiP]