Structure of PDB 6s13 Chain H

Receptor sequence

>6s13H (length=145) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVD
TGDYVIVINASKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPER
LIENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYELRG

3D structure

PDB

6s13 Exit tunnel modulation as resistance mechanism of S. aureus erythromycin resistant mutant.

Chain

Resolution

3.58 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	M1 T4 M6 N8 W16 G27 R28 S31 K40 H48 Y54 T66 K69 K73 Y76 R77 H78 S79 N80 K86 R100 G108 M109 P111 R114 L115 K121 H133 A135 Q136 Q137	M1 T4 M6 N8 W16 G27 R28 S31 K40 H48 Y54 T66 K69 K73 Y76 R77 H78 S79 N80 K86 R100 G108 M109 P111 R114 L115 K121 H133 A135 Q136 Q137

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links