Structure of PDB 6pwe Chain H

Receptor sequence
>6pweH (length=94) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
RKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
3D structure
PDB6pwe Structure of the primed state of the ATPase domain of chromatin remodeling factor ISWI bound to the nucleosome.
ChainH
Resolution3.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H R30 K31 I36 Y37 R3 K4 I9 Y10
BS02 dna H R30 Y39 G50 I51 S53 R83 T85 R3 Y12 G23 I24 S26 R56 T58
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0044877 protein-containing complex binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6pwe, PDBe:6pwe, PDBj:6pwe
PDBsum6pwe
PubMed31402386
UniProtP02283|H2B_DROME Histone H2B (Gene Name=His2B)

[Back to BioLiP]