Structure of PDB 6o1l Chain H |
>6o1lH (length=67) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
HSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMV YKHAISTVVPSRPVRLP |
|
PDB | 6o1l Architectural principles for Hfq/Crc-mediated regulation of gene expression. |
Chain | H |
Resolution | 3.37 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
H |
Y25 I30 Q52 T61 |
Y21 I26 Q48 T57 |
|
|
|
|