Structure of PDB 6l35 Chain H |
>6l35H (length=90) Species: 3218 (Physcomitrium patens) [Search protein sequence] |
SVYFDLGEIDNTTGNWDLYGNDDPNRYNGFQNKFFETFAGAFTKRGLLLK FLVLGGATTIGYLGSTSSPDLLAIKNGPKQVPVMGPRGRK |
|
PDB | 6l35 Antenna arrangement and energy-transfer pathways of PSI-LHCI from the moss Physcomitrella patens. |
Chain | H |
Resolution | 3.23 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CLA |
H |
R76 Y77 |
R26 Y27 |
|
|
|
|