Structure of PDB 6k0b Chain H

Receptor sequence

>6k0bH (length=120) Species: 243232 (Methanocaldococcus jannaschii DSM 2661)

KKFLEKKLKKIAYERIDILMSLAEEEAKKGNWDRAKRYVYLARRIAMKMR
IRFPKKWKRRICKKCGTFLLYGRNARVRIKSKRYPHVVITCLECGAIYRI
PMIREKKEKRRKKLEERLKA

3D structure

• PDB: 6k0b Cryo-electron microscopy structure of an archaeal ribonuclease P holoenzyme.
• Chain: H
• Resolution: 4.3 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.5: ribonuclease P.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	K8 K10 M48 K49 R51	K7 K9 M47 K48 R50
BS02	rna	H	R51 R53 K59 R60 K64 R77 R79 K81 S82 K83 R84 Y85 H87 V89 R100 P102 R105 K107 K108 K110 R111 R112 K114 L115 R118	R50 R52 K58 R59 K63 R76 R78 K80 S81 K82 R83 Y84 H86 V88 R99 P101 R104 K106 K107 K109 R110 R111 K113 L114 R117
BS03	ZN	H	C66 C95	C65 C94

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity
• GO:0004526 ribonuclease P activity
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001682 tRNA 5'-leader removal
• GO:0006396 RNA processing
• GO:0008033 tRNA processing

Cellular Component

• GO:0005737 cytoplasm
• GO:0030677 ribonuclease P complex
• GO:1902555 endoribonuclease complex
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6k0b, PDBe:6k0b, PDBj:6k0b
• PDBsum: 6k0b
• PubMed: 31197137
• UniProt: Q58372|RNP4_METJA Ribonuclease P protein component 4 (Gene Name=rnp4)