Structure of PDB 6gc4 Chain H

Receptor sequence
>6gc4H (length=50) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEAR
3D structure
PDB6gc4 Structural Visualization of the Formation and Activation of the 50S Ribosomal Subunit during In Vitro Reconstitution.
ChainH
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H A23 G24 Y25 R27 N28 A23 G24 Y25 R27 N28
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gc4, PDBe:6gc4, PDBj:6gc4
PDBsum6gc4
PubMed29883607
UniProtP0A7R1|RL9_ECOLI Large ribosomal subunit protein bL9 (Gene Name=rplI)

[Back to BioLiP]