Structure of PDB 6fol Chain H |
>6folH (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] |
NLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQY GDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRME DEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIAR |
|
PDB | 6fol Molecular recognition and maturation of SOD1 by its evolutionarily destabilised cognate chaperone hCCS. |
Chain | H |
Resolution | 2.55 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
H |
H147 H155 H164 D167 |
H63 H71 H80 D83 |
|
|
|
|