Structure of PDB 6et9 Chain H |
>6et9H (length=128) Species: 2186 (Methanothermococcus thermolithotrophicus) [Search protein sequence] |
VVRSWRHMKERYNLIGTRCKTCGKVYFPSRTVCPDCRRKGELEEFQLSGK GKIYTYSIVYAPPKEFNKLTPYVIAIVELEEGPKVTAQVDCDINKISIGI PVEAAFRRIKEDGKDGIISYGYKFVPIT |
|
PDB | 6et9 Archaeal acetoacetyl-CoA thiolase/HMG-CoA synthase complex channels the intermediate via a fused CoA-binding site. |
Chain | H |
Resolution | 2.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
H |
C20 C23 C37 |
C19 C22 C36 |
|
|
|
|