Structure of PDB 6eo9 Chain H

Receptor sequence

>6eo9H (length=250) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF

3D structure

• PDB: 6eo9 How a beta-D-glucoside side chain enhances binding affinity to thrombin of inhibitors bearing 2-chlorothiophene as P1 moiety: crystallography, fragment deconstruction study, and evaluation of antithrombotic properties.
• Chain: H
• Resolution: 1.84 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 G25 M26 P28 W29 D116 H119 P120 C122 L129C Y134 K135 G136 R137 N159 K186D K202 P204 N205 R206 W207	E8 G10 M11 P13 W14 D113 H116 P117 C119 L129 Y134 K135 G136 R137 N157 K189 K205 P207 N210 R211 W212
BS02	peptide	H	Q38 R67 R73 T74 R75 Y76 K81 I82	Q24 R62 R68 T69 R70 Y71 K77 I78
BS03	2OJ	H	E97A I174 A190 V213 W215 G216 E217 G219 G226 F227 Y228	E94 I172 A193 V218 W220 G221 E222 G223 G231 F232 Y233	MOAD: Ki=160nM PDBbind-CN: -logKd/Ki=6.80,Ki=160nM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:6eo9, PDBe:6eo9, PDBj:6eo9
• PDBsum: 6eo9
• PubMed: 25268757
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)