Structure of PDB 6eo8 Chain H

Receptor sequence

>6eo8H (length=247) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEQPSV
LQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPF
VMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQ

3D structure

• PDB: 6eo8 How a beta-D-glucoside side chain enhances binding affinity to thrombin of inhibitors bearing 2-chlorothiophene as P1 moiety: crystallography, fragment deconstruction study, and evaluation of antithrombotic properties.
• Chain: H
• Resolution: 1.94 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 G25 M26 P28 W29 D116 H119 P120 C122 Y134 K135 R137 N159 K186D M201 K202 N205 R206 W207	E8 I9 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N155 K187 M202 K203 N208 R209 W210
BS02	peptide	H	F34 Q38 R67 R73 T74 Y76 I82	F19 Q24 R62 R68 T69 Y71 I78
BS03	2FN	H	I174 D189 A190 V213 W215 G216 E217 G219 R221A G226 F227 Y228	I170 D190 A191 V216 W218 G219 E220 G221 R224 G229 F230 Y231	MOAD: Ki=100nM PDBbind-CN: -logKd/Ki=7.00,Ki=100nM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:6eo8, PDBe:6eo8, PDBj:6eo8
• PDBsum: 6eo8
• PubMed: 25268757
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)