Structure of PDB 6d6v Chain H

Receptor sequence

>6d6vH (length=108) Species: 5911 (Tetrahymena thermophila)

NCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDGQAMIRFQNSDEQRL
AIQKLLNHNNNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKNEFRKF
FFMKKQQK

3D structure

• PDB: 6d6v Structure of Telomerase with Telomeric DNA.
• Chain: H
• Resolution: 4.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	K392 A393 V396 R400 Y407 I514 K517 K518 E520 F521 R522 F526 K528	K15 A16 V19 R23 Y30 I90 K93 K94 E96 F97 R98 F102 K104

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0070034 telomerase RNA binding

Biological Process

• GO:0007004 telomere maintenance via telomerase
• GO:0090669 telomerase RNA stabilization
• GO:1904868 telomerase catalytic core complex assembly

Cellular Component

• GO:0000781 chromosome, telomeric region
• GO:0005694 chromosome
• GO:0005697 telomerase holoenzyme complex

External links

• PDB: RCSB:6d6v, PDBe:6d6v, PDBj:6d6v
• PDBsum: 6d6v
• PubMed: 29775593
• UniProt: W7X6T2|LARP7_TETTS La-related protein 7 homolog (Gene Name=TAP65)