Structure of PDB 6boh Chain H

Receptor sequence

>6bohH (length=181) Species: 262724 (Thermus thermophilus HB27)

PLDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 6boh Conformational Control of Translation Termination on the 70S Ribosome.
• Chain: H
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	N40 G42 L43 G44 E45 T71 A73 K74 I77 F80 I88 S124 D126 R128 N132 L133 G134 L135 G154 D156	N39 G41 L42 G43 E44 T70 A72 K73 I76 F79 I87 S123 D125 R127 N131 L132 G133 L134 G153 D155
BS02	rna	H	P2 N27 V28 W29 E30 Q66 K67 A69 V70 V92 T93 R95 R96 R98	P1 N26 V27 W28 E29 Q65 K66 A68 V69 V91 T92 R94 R95 R97
BS03	rna	H	S76 S78 R83	S75 S77 R82

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6boh, PDBe:6boh, PDBj:6boh
• PDBsum: 6boh
• PubMed: 29731232
• UniProt: Q72I16|RL5_THET2 Large ribosomal subunit protein uL5 (Gene Name=rplE)