Structure of PDB 6bk8 Chain H

Receptor sequence

>6bk8H (length=70) Species: 559292 (Saccharomyces cerevisiae S288C)

TTSHRPQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKSWRKGTAFGR
YINDMTKSEYHQEFLHKHVR

3D structure

• PDB: 6bk8 Structure of the yeast spliceosomal postcatalytic P complex.
• Chain: H
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	H5 R6 P7 L9	H4 R5 P6 L8
BS02	rna	H	R29 P32 G33 H34	R28 P31 G32 H33
BS03	rna	H	T3 S4 R6 Q8 R12 K16 H27 R29	T2 S3 R5 Q7 R11 K15 H26 R28

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:6bk8, PDBe:6bk8, PDBj:6bk8
• PDBsum: 6bk8
• PubMed: 29146870
• UniProt: Q03772|CWC15_YEAST Pre-mRNA-splicing factor CWC15 (Gene Name=CWC15)