Structure of PDB 5vsu Chain H

Receptor sequence

>5vsuH (length=100) Species: 559292 (Saccharomyces cerevisiae S288C)

SATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRKEFICKA
QLLRGSEIALVGLIDALAPIDEKKVPMLKDTKNKIENEHVIWEKVYESKT

3D structure

• PDB: 5vsu Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
• Chain: H
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	F30 N33 N35 R57 S59	F29 N32 N34 R54 S56

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006364 rRNA processing
• GO:0006397 mRNA processing
• GO:0008033 tRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005688 U6 snRNP
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071001 U4/U6 snRNP
• GO:0071011 precatalytic spliceosome

External links

• PDB: RCSB:5vsu, PDBe:5vsu, PDBj:5vsu
• PDBsum: 5vsu
• PubMed: 29717126
• UniProt: P47093|LSM8_YEAST U6 snRNA-associated Sm-like protein LSm8 (Gene Name=LSM8)