Structure of PDB 5oki Chain H

Receptor sequence

>5okiH (length=131) Species: 559292 (Saccharomyces cerevisiae S288C)

PSVDIDASQWQKLTQSREKQTTVITPLGMMMLEIQGELELPKDFASLARR
DSPNEGRFSEQDGETLIRFGSLQIDGERATLFVGKKQRLLGKVTKLDVPM
GIMHFNSKDNKVELVDVMKYKVIFKDRPLPI

3D structure

• PDB: 5oki Structural Basis for the Recruitment of Ctf18-RFC to the Replisome.
• Chain: H
• Resolution: 4.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	P2 Q36 G37 E38 E40 K87 Q88 S108 N111 R128 P129	P1 Q35 G36 E37 E39 K86 Q87 S107 N110 R127 P128

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003677 DNA binding
• GO:0005515 protein binding

Biological Process

• GO:0006260 DNA replication
• GO:0007064 mitotic sister chromatid cohesion
• GO:0034398 telomere tethering at nuclear periphery
• GO:0035753 maintenance of DNA trinucleotide repeats

Cellular Component

• GO:0005634 nucleus
• GO:0031390 Ctf18 RFC-like complex

External links

• PDB: RCSB:5oki, PDBe:5oki, PDBj:5oki
• PDBsum: 5oki
• PubMed: 29225079
• UniProt: P38877|CTF8_YEAST Chromosome transmission fidelity protein 8 (Gene Name=CTF8)