Structure of PDB 5okc Chain H

Receptor sequence
>5okcH (length=128) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
PSVDIDASQWQKLTQSRTVITPLGMMMLEIQGELELPKDFASLARRDSPN
EGRFSEQDGETLIRFGSLQIDGERATLFVGKKQRLLGKVTKLDVPMGIMH
FNSKDNKVELVDVMKYKVIFKDRPLPIM
3D structure
PDB5okc Structural Basis for the Recruitment of Ctf18-RFC to the Replisome.
ChainH
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide H P2 S3 V4 Q36 G37 E38 E40 F70 V84 G85 Q88 F106 N107 S108 N111 K126 D127 R128 P129 P1 S2 V3 Q31 G32 E33 E35 F65 V79 G80 Q83 F101 N102 S103 N106 K121 D122 R123 P124
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006260 DNA replication
GO:0007064 mitotic sister chromatid cohesion
GO:0034398 telomere tethering at nuclear periphery
GO:0035753 maintenance of DNA trinucleotide repeats
Cellular Component
GO:0005634 nucleus
GO:0031390 Ctf18 RFC-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5okc, PDBe:5okc, PDBj:5okc
PDBsum5okc
PubMed29225079
UniProtP38877|CTF8_YEAST Chromosome transmission fidelity protein 8 (Gene Name=CTF8)

[Back to BioLiP]